PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Csa06g028720.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Camelina
Family GRAS
Protein Properties Length: 667aa    MW: 72814.8 Da    PI: 6.2373
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Csa06g028720.1genomeCSGPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS424.96.6e-1303046632374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lLl+cAeavs+++le+a++lL ++s+l++p+g++ qR+aayf eA++arl++s+ ++y+alp++  ++++s + ++a+++f+ +sP++kfsh+
  Csa06g028720.1 304 LTLLLQCAEAVSADNLEEANKLLLEISQLSTPYGTSAQRVAAYFSEAMSARLLNSCLGIYAALPSRWMPQTHSLKMVSAFQVFNGISPLVKFSHF 398
                     579******************************************************************************************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                     taNqaI ea+e+e+ vHiiD+di+qGlQWp L++ LasRp+gpp++R+Tg+g     s e+l++tg+rL++fA++lg+pfef + +a+++ +l++
  Csa06g028720.1 399 TANQAIQEAFEKEDSVHIIDLDIMQGLQWPGLFHILASRPGGPPHVRLTGLGT----SMEALQATGKRLSDFADKLGLPFEFCP-LAEKVGNLDT 488
                     *****************************************************....***************************.59******** PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                     e+L+v+++Ea+aV++    h+l+d ++s ++    +L+l+++l Pkvv+vveq+++h ++sFl rf+ea++yysalfdsl a++++eseer++vE
  Csa06g028720.1 489 ERLNVRKREAVAVHWLQ--HSLYDVTGSDAH----TLWLLQRLAPKVVTVVEQDLSH-AGSFLGRFVEAIHYYSALFDSLGASYGEESEERHVVE 576
                     ****************9..999988888888....**********************.899********************************** PP

            GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++ll++ei+nv+a  g +r  + + +e+Wre+++++GFk ++l  +aa+qa lll +++sdgy++ +++g+l +gWkd +L+++SaW+
  Csa06g028720.1 577 QQLLSKEIRNVLAVGGPSRSGEVK-FESWREKMQQCGFKGISLAGNAATQATLLLGMFPSDGYTLVDDNGTLKFGWKDLSLLTASAWT 663
                     ******************888776.**************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.608277643IPR005202Transcription factor GRAS
PfamPF035142.3E-127304663IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 667 aa     Download sequence    Send to blast
MADSGDFNGG QPPHSPLRAT SSGSSSSNNR SGAPPQPPPP PLVMVRKRLA SEMSSNPDYN  60
NPSRPPRRAS HLLDSNYNTV PPQQQQQQPP SLAAATAVAS QPNPPLSVCG FSGLPVFPSD  120
RGGGGRNAMS VQPMEQDSSS SSASPTVWVD AIIRDLIHSS TSVSIPQLIQ NVRDIIFPCN  180
PNLGALLEYR LRSLMLLDPS SSSDPSPQSF EPLYQISNNP SPPVTQHQQQ QQQHQQQQPQ  240
QQHKTPPPPP IQQQERENSS TDAPPQPETV TTTTATVTNT AEALRERKEE IKRQKQDEEG  300
LHLLTLLLQC AEAVSADNLE EANKLLLEIS QLSTPYGTSA QRVAAYFSEA MSARLLNSCL  360
GIYAALPSRW MPQTHSLKMV SAFQVFNGIS PLVKFSHFTA NQAIQEAFEK EDSVHIIDLD  420
IMQGLQWPGL FHILASRPGG PPHVRLTGLG TSMEALQATG KRLSDFADKL GLPFEFCPLA  480
EKVGNLDTER LNVRKREAVA VHWLQHSLYD VTGSDAHTLW LLQRLAPKVV TVVEQDLSHA  540
GSFLGRFVEA IHYYSALFDS LGASYGEESE ERHVVEQQLL SKEIRNVLAV GGPSRSGEVK  600
FESWREKMQQ CGFKGISLAG NAATQATLLL GMFPSDGYTL VDDNGTLKFG WKDLSLLTAS  660
AWTPRS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-503036624374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0563150.0AY056315.1 Arabidopsis thaliana putative SCARECROW1 protein (At3g54220) mRNA, complete cds.
GenBankAY0808400.0AY080840.1 Arabidopsis thaliana putative SCARECROW1 protein (At3g54220) mRNA, complete cds.
GenBankAY1139910.0AY113991.1 Arabidopsis thaliana putative SCARECROW1 protein (At3g54220) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010515939.10.0PREDICTED: protein SCARECROW-like
SwissprotQ9M3840.0SCR_ARATH; Protein SCARECROW
TrEMBLR0HIE10.0R0HIE1_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.5__1811__AT3G54220.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM81642640
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G54220.10.0GRAS family protein